SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000327716 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000327716
Domain Number - Region: 39-94
Classification Level Classification E-value
Superfamily Tropomyosin 0.0602
Family Tropomyosin 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000327716
Sequence length 174
Comment WRB (Homo_sapiens) tryptophan rich basic protein
Sequence
MGAPEADRWAWLLVLSFVFGCNVLRILLPSFSSFMSRVLQKDAEQESHMRAEIQDMKQEL
ASVNMMDEFARYARLERKINKMTDRLKTHVKARTAQLAKIKWVISVVFYILQAALMISLI
WKYYSVPVAVVPSKWITPLDRLVAFPTRVAGGVGITCWILVCNKVVAIVLHPFS
Download sequence
Identical sequences G5AM06
HGL_H00000327716 XP_004842419.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]