SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000328083 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000328083
Domain Number 1 Region: 22-224
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.54e-45
Family DBL homology domain (DH-domain) 0.00026
Further Details:      
 
Domain Number 2 Region: 258-449
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.8e-39
Family BAR domain 0.0055
Further Details:      
 
Domain Number 3 Region: 594-674
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-18
Family SH3-domain 0.00069
Further Details:      
 
Domain Number 4 Region: 496-570
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000021
Family SH3-domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000328083
Sequence length 676
Comment ARHGEF37 (Homo_sapiens) Rho guanine nucleotide exchange factor (GEF) 37
Sequence
MAHCGTDEPSSGSLDGEGQSLEDRSLLQQSLAIRELMDTEDSYLHMLRLCASDVRSRLQQ
LPQGDLDVLFSNIDEIIQVSSRFLHGLQETASKEEKQVLLIGNLFLEFQEDFEQVYKVYC
ANYDQALLLLKAYQKEPELQQEIQSIIQAVVPQAGPSGLSFILVIPLQRVTKYPLLLQKI
LENTLPDASAYPVLLRATSALQDVNANINEYKMRKEVALQVASLILQMRHLRSQGMVTCQ
NRAALSKKTTRLSQMLKQEAGLVPRTEDKEFDDLEEKFQWVSLCVTELKNNVATYLDNLE
AFLHFRPHECDLDIPGGPVVQYCSLARDLQHEAFLEFKQRLKGLVWRPLCSLAKALVGPQ
NLIKKRLDKLLDFERLEEKLLEVGSMTYEEEAARHTYQALNSLLVAELPKFNQLVVEWLG
QILRTFMALQRDLAKQVLQRAEGSISQLPHHHISEPAFRKLVEDTLGQTSTQLLSFRENF
EKVLPPSTSQPLLPGSESQVQALLSKYGPGKLYQTTSNISGAGTLDLTLSRGQIVALLQN
KDTKGHSSRWLVDTGGHRGYVPAGKLQLYRVIPSEEHRGQAGVQQDSHHLAPAPAPALVP
STPTVTQVVAAYPFMARSTHEVSLQAGQPVTILEAHDKKGNPEWSLVEVNGQRGYVPSGF
LARAPSPAPWGWTLPS
Download sequence
Identical sequences G5C3A2
HGL_H00000328083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]