SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000328150 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000328150
Domain Number 1 Region: 169-363
Classification Level Classification E-value
Superfamily E set domains 1.17e-79
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000852
Further Details:      
 
Domain Number 2 Region: 63-185
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.22e-24
Family Voltage-gated potassium channels 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000328150
Sequence length 433
Comment KCNJ12 (Homo_sapiens) potassium inwardly-rectifying channel, subfamily J, member 12
Sequence
MTAASRANPYSIVSSEEDGLHLVTMSGANGFGNGKVHTRRRCRNRFVKKNGQCNIEFTNM
DEKSQRYLADMFTTCVDIRWRYMLLIFSLAFLASWLLFGVIFWVIAVAHGDLEPAEGRGR
TPCVMQVHGFMAAFLFSIETQTTIGYGLRCVTEECPVAVFMVVAQSIVGCIIDSFMIGAI
MAKMARPKKRAQTLLFSHNAVVALRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRVTEE
GEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPLFGISRQDLETDDFEIVVILE
GMVEATAMTTQARSSYLANEILWGHRFEPVLFEEKNQYKIDYSHFHKTYEVPSTPRCSAK
DLVENKFLLPSANSFCYENELAFLSRDEEDEPEGDQDGCSREGLSPQPRHDFDRRQAGGG
ALEQRPYRRESEI
Download sequence
Identical sequences G5BKM9
XP_004868810.1.39548 XP_012922470.1.39548 HGL_H00000328150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]