SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000328160 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000328160
Domain Number 1 Region: 932-1043
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.49e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.00034
Further Details:      
 
Domain Number 2 Region: 401-572
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.77e-28
Family G proteins 0.0000000382
Further Details:      
 
Domain Number 3 Region: 672-737,872-915
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000051
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 4 Region: 1055-1147
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000912
Family Ankyrin repeat 0.0031
Further Details:      
 
Weak hits

Sequence:  HGL_H00000328160
Domain Number - Region: 266-349
Classification Level Classification E-value
Superfamily Bacterial luciferase-like 0.00805
Family F420 dependent oxidoreductases 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000328160
Sequence length 1190
Comment AGAP2 (Homo_sapiens) ArfGAP with GTPase domain, ankyrin repeat and PH domain 2
Sequence
MSRGAGALQRRTTTYLISLTLVKLESVPPPPPSPSAAAAGALGARGTEPGDPGSPRGAEE
PGKKRHERLFHRQDALWISTSSAGAGGAEPPALSPAPASPARPVSPAPGRRLSLWAAPPG
PPLSGGLSPDPKPGGAPTSSRRPLLSSPSWGGPEPEGRLGGGVPGSSSPHPGTGSRRLKV
APPPPAPKPCKTVTTSGAKAGGGKGAGSRLSWPESEGKPRVKGSKSSAGTGASAATAAAA
AGPGGAAATTSGGVGAGAGARGKLSPRKGKSKTLDNSDLHPGPPAGSPPPLTIPATPGPA
AAVAAASAQPPGPAPPITLEPPAPGLKRGREGGRASTRDRKMLKFISGIFTKSTGGPPGS
GPPSGPSGLSSGSGSRELLGAELRASPKAVVNSQEWTLSRSIPELRLGVLGDTRSGKSSL
IHRFLTGSYQVLEKSESEQYKKEMLVEGQTHLVLIREEAGAPDAKFSGWADAVIFVFSLE
DENSFQAVSHLHGQLSSLRGEGRGGLALALVGTQDRISASSPRVVGDARARALCADMKRC
SYYETCATYGLNVDRVFQEVAQKVVTLRKQQQLLAACKSLPSSPSHSAASTPVAGQASNG
GHTSDYSSSLPSSPNVGHRELRAEVAAVAGLSTPGSLHRAAKRRTSLFANRRGSDSEKRS
LDSRGETTGSGRAIPIKQSFLLKRSGNSLNKEWKKKYVTLSSNGFLLYHPSINDYIHSTH
GKEMDLLRTTVKVPGKRPPRAISAFGPSASINGLVKDMSTVQMGEGPEATIPTPSPSPSP
SSLQPPPDQTSKHLLKPDRNLARALSTDCTPSGDLSPLSREPPPSPMVKKQRRKKLTTPS
KTEGAAVQAEAKRKMWKLKSFGSLRNIYKAEENFEFLIVSSTGQTWHFEAASFEERDAWV
QAIESQILASLQCCESSKVKLRTDSQSEAVAIQAIRNAKGNSICVDCGAPNPTWASLNLG
ALICIECSGIHRNLGTHLSRVRSLDLDDWPRELTLVLTAIGNDMANRVWESDTRGRPKPT
KDSSREERESWIRAKYEQLLFLAPLGTTEEPLGRQLWAAVQAQDVAAVLLLLAHARHGPL
DTSGEDPQLRSPLHLAAELAHVVITQLLLWYGADVAARDAQSRTALFYARQAGSQLCADI
LLQHGCPGEGGSAATTPSAATTPSITATPSPRRRSSAASVGRADAPVALV
Download sequence
Identical sequences G5BEC0
HGL_H00000328160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]