SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000328327-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000328327-1
Domain Number 1 Region: 18-255
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.27e-58
Family Ankyrin repeat 0.0000828
Further Details:      
 
Domain Number 2 Region: 269-313
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000471
Family SOCS box-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000328327-1
Sequence length 318
Comment ASB7 (Homo_sapiens) ankyrin repeat and SOCS box-containing 7
Sequence
MLHHHCRRNPELQEELQIQAAVAAGDVHTVRKMLEQGYSPNGRDANGWTLLHFSAARGKE
RCVRVFLEHGADPTVKDLIGGFTALHYAAMHGRARIARLMLESEYRSDIINAKSNDGWTP
LHVAAHYGRDSFVRLLLEFKAEVDPLSDKGTTPLQLAIIRERSSCVKILLDHNANIDIQN
GFLLRYAVIKSNHSYCRMFLQRGADTNLGRLEDGQTPLHLSALRDDVLCARMLYNYGADT
NTRNYEGQTPLAVSISISGSSRPCLDFLQEVTRQPRNLQDLCRIKIRQCIGLQNLKLLDE
LPIAKVMKDYLKHKFDDI
Download sequence
Identical sequences A0A024RC94 A0A091CQS6 A0A096NNE9 A0A0D9RWC7 A0A1D5QSD9 A0A1S3EU44 A0A1U7UES3 A0A250XYC7 A0A286XHC1 A0A2I2ZMY0 A0A2I3TIK7 A0A2K5ED21 A0A2K5IVZ1 A0A2K5R6H8 A0A2K5Z6G3 A0A2K6DYL8 A0A2K6EWB3 A0A2K6LTQ9 A0A2K6R186 A0A2K6UF43 D2HK39 E1B9S2 E2R0E1 F2Z5S9 G1QJX0 G3T6A6 G5ARY9 G7P9J5 H0WHL6 H2NPB7 I3N0G0 L8IXE5 M3WV72 M3YHL4 Q9H672 U6CT78 W5PIU0
ENSOARP00000010360 ENSP00000328327 ENSCPOP00000004456 10141.ENSCPOP00000004456 9544.ENSMMUP00000021689 9598.ENSPTRP00000012822 9600.ENSPPYP00000007739 9606.ENSP00000328327 9615.ENSCAFP00000015703 9685.ENSFCAP00000009434 9823.ENSSSCP00000005193 9913.ENSBTAP00000013884 ENSOGAP00000000869 ENSSSCP00000005193 ENSP00000328327 ENSMMUP00000021689 ENSSSCP00000005193 gi|38176283|ref|NP_937886.1| ENSVPAP00000008249 ENSFCAP00000018259 ENSCPOP00000004456 ENSNLEP00000001215 ENSDORP00000007933 ENSPANP00000014509 ENSLAFP00000009039 ENSPTRP00000012822 HGL_H00000328327-1 ENSCAFP00000015703 NP_001179080.1.59421 NP_001179080.1.76553 NP_001253218.1.72884 NP_937886.1.87134 NP_937886.1.92137 XP_002922717.1.58354 XP_003121694.1.46622 XP_003277600.2.23891 XP_003413957.1.64505 XP_003475323.1.53824 XP_003788680.1.62490 XP_003828479.1.60992 XP_003940589.1.74449 XP_003986916.2.62641 XP_004017761.1.66739 XP_004056875.2.27298 XP_004271696.1.21590 XP_004321155.2.83887 XP_004372704.1.4749 XP_004431948.1.5094 XP_004693146.1.23501 XP_004759896.1.14098 XP_004852734.1.39548 XP_005221775.1.76553 XP_005320142.1.77405 XP_005381695.1.28644 XP_005560666.1.63531 XP_005659848.1.46622 XP_005889022.1.15283 XP_006053814.1.26621 XP_006053815.1.26621 XP_006053816.1.26621 XP_006182729.1.101512 XP_006211554.1.17985 XP_006742737.1.47382 XP_007095925.1.5354 XP_007119429.1.24612 XP_007191213.1.59432 XP_007458520.1.90284 XP_007958129.1.48129 XP_007988762.1.81039 XP_008067203.1.4292 XP_008533687.1.77740 XP_008533688.1.77740 XP_008685806.1.72690 XP_010379989.1.97406 XP_010592169.1.64505 XP_010609385.1.5607 XP_010844115.1.44457 XP_010844116.1.44457 XP_010961199.1.22495 XP_010983635.1.51371 XP_011770077.1.29376 XP_011812859.1.43180 XP_011820639.1.47321 XP_012025448.1.54773 XP_012319302.1.9421 XP_012419637.1.74151 XP_012498173.1.63892 XP_012620029.1.48125 XP_012620030.1.48125 XP_012620031.1.48125 XP_012867469.1.60039 XP_013848687.1.46622 XP_014709699.1.49734 XP_014709700.1.49734 XP_014924495.1.86478 XP_015348615.1.40921 XP_017374294.1.71028 XP_017718885.1.44346 XP_017921918.1.57651 XP_019315634.1.44245 XP_019839079.1.53367 XP_019839080.1.53367 XP_020041222.1.5219 XP_020752868.1.74333 XP_020752877.1.74333 XP_020752887.1.74333 XP_020752898.1.74333 XP_020752907.1.74333 XP_020954217.1.46622 XP_021536177.1.83697 XP_021578531.1.77405 XP_523240.4.37143 XP_545824.1.84170 ENSPPYP00000007739 ENSCAFP00000015703 ENSLAFP00000009039 ENSMPUP00000010821 ENSMMUP00000021689 ENSDORP00000007933 ENSGGOP00000019900 ENSVPAP00000008249 ENSBTAP00000013884 ENSP00000328327 ENSPPYP00000007739 ENSFCAP00000009434 ENSMPUP00000010821 ENSGGOP00000019900 ENSBTAP00000013884 ENSPTRP00000012822 ENSOGAP00000000869 ENSNLEP00000001215 ENSNLEP00000023344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]