SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000328327-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000328327-2
Domain Number 1 Region: 80-181
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.95e-28
Family Ankyrin repeat 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000328327-2
Sequence length 191
Comment ASB7 (Homo_sapiens) ankyrin repeat and SOCS box-containing 7
Sequence
MLSREALVLLPPGGQGAAAQQSLLDRVSTRSWTQCSSVPVALRSDLAGGEAAFSCTWRMV
SPGARASAGQAPPRLSCVPAARNGQKKCMSKLLEYGADVNICNNEGLTAIHWLAVNGRTE
LLHDLVQHVSDVDVEDAMGQTALHVACQNGLKTTVQCLLDSGADINRPNVSGAAPLYFAC
RPCPCWTRSLC
Download sequence
Identical sequences HGL_H00000328327-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]