SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000328813 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000328813
Domain Number 1 Region: 213-376,409-471
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.72e-38
Family Voltage-gated potassium channels 0.0034
Further Details:      
 
Domain Number 2 Region: 476-658
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.11e-36
Family cAMP-binding domain 0.00093
Further Details:      
 
Domain Number 3 Region: 34-130
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.98e-21
Family Flavin-binding PAS domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000328813
Sequence length 1089
Comment KCNH8 (Homo_sapiens) potassium voltage-gated channel, subfamily H (eag-related), member 8
Sequence
MSPPDHKVMATALHTTILLQDSNFILANAQVAKGFPIVYCSDGFCELAGFARTEVMQKSC
SCKFLFGVETNEQLMLQIEKSLEEKSEFKGEIMFYKKNGSPFWCLLDIVPIKNEKGDVVL
FLASFKDITDTKVKITPEDKKEDKAKGRSRAGTHFDSARRRSRAVLYHISGHLQRREKNK
LKINNNVFVDKPAFPEYKVSDAKKSKFILLHFSTFKAGWDWLILLATFYVAVTVPYNVCF
IGNDELSTTRSTTVSDIAVEILFIIDIILNFRTTYVSKSGQVIFEARSICIHYVTTWFII
DLIAALPFDLLYAFNVTVVSLVHLLKTVRLLRLLRLLQKLDRYSQHSTIVLTLLMSMFAL
LAHWMACIWYVIGKMEREDNSLLKWEVGWLHELGKRLESPYYGNSTLGGPSIRSAYIAAL
YFTLSSLTSVGFGNVSANTDAEKIFSICTMLIGALMHALVFGNVTAIIQRMYSRWSLYHT
RTKDLKDFIRVHHLPQQLKQRMLEYFQTTWSVNNGIDSNELLKDFPDELRSDITMHLNKE
ILQLSLFECASRGCLRSLSLHIKTSFCAPGEYLLRQGDALQAIYFVCSGSMEVLKDSMVL
AILGKGDLIGANLSIKDQVIKTNADVKALTYCDLQCIILKGLFEVLDLYPEYAHKFVEDI
QHDLTYNLREGHESDSEPKGNGSINKRLPSIVEDEEEEEGEEEETASLSPIYTRRSTSSR
SKKVGNNKTYLGLSLKQLASGTVPFHSPIRVSSSNSPKTKQETDPPNHNKRKEKNLKLQL
SILNSSGPPDLSPRIVDGIEDGNSSEESQTFDFGSERMRPEPRVSPPLGDPEIGTAVLFI
KAEETKQQINKLNSEVTTLTQEVSQLGKDMRNVMQLLENVLSPQQPSHHCSLHAASVCPS
RESLQTRMNWSTHQPCLHLQTGMAAYNQAQLCHSNIASDIWNVDPSSVGSSPHRTGVHKQ
NPADSDLCHSPNLEYSPSHYQVVQEGHFQFLRCISPHSDTTLTPLQSISATLSSSVCSSS
ETSLHLVLPSRSEEGSFSQGPVSSFSLENLPGSWDREGTASVSTKPLENFPLEVITSTAS
VKDNKAINV
Download sequence
Identical sequences G5B2V6
HGL_H00000328813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]