SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000329200 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000329200
Domain Number 1 Region: 226-297
Classification Level Classification E-value
Superfamily SH3-domain 6.3e-18
Family SH3-domain 0.00065
Further Details:      
 
Domain Number 2 Region: 76-134
Classification Level Classification E-value
Superfamily Cysteine-rich domain 9.72e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.006
Further Details:      
 
Domain Number 3 Region: 303-358
Classification Level Classification E-value
Superfamily SH3-domain 0.0000367
Family SH3-domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000329200
Sequence length 358
Comment STAC3 (Homo_sapiens) SH3 and cysteine rich domain 3
Sequence
EVLESPKPSLPAETPQSGLQRLKQLFRKESPETKEMELPPEPQANGEAVGAGGGPIYYIY
EEEEEEEEEEPPPEPPKLVNDKPHKFKDHFFKKPKFCDVCARMIVLNNKFGLRCKNCKTN
IHEHCQSYVEMQRCFGKIPPGFRRAYSSPLYSNQQYACVKDPSAANRNDPVFETLRTGVI
MANKERKKGQADKKNLLTAMMEEEPESAKPEEGKAQDGNPEGNKKAEKKTPDDKHKQPGF
QQSHYFVALYRFKALEKDDLDFPPGEKIIVIDDSNEEWWRGKIGEKVGFFPPNFIIRVRA
GERVHRVTRSFVGNREIGQITLKKDQIVVQKGDEAGGYVKVYTGRKVGLFPTDFLEEI
Download sequence
Identical sequences G5BED9
HGL_H00000329200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]