SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000329918-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000329918-2
Domain Number 1 Region: 93-161
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.09e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 2 Region: 7-71
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 3 Region: 448-497
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000104
Family RING finger domain, C3HC4 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000329918-2
Sequence length 502
Comment MEX3B (Homo_sapiens) mex-3 homolog B (C. elegans)
Sequence
MTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVAMARR
EIISAAEHFSMIRASRNKNTALNGAVPGPPNLPGQTTIQVRVPYRVVGLVVGPKGATIKR
IQQQTHTYIVTPSRDKEPVFEVTGMPENVDRAREEIEAHIALRTGGIVELTDENDFHANG
TDVGFDLHHGSGGSGPGSLWSKPTPSITPTPGRKPFSSYRNDSSSSLGSASTDSYFGGGT
SGSAAATPRLADYSPPSPALSFSHNGNNNNNGNGYTYPAGDAPAQSPEGCSELQPTFDPA
PAPPPGAPLLWAQFERSPGGGSAAPVSSSCSSASSSASSSSVVFPGGGAGGPSNANLGLL
VHRRLHPGTSCPRLSPPLHMAPGAGEHHLARRVRSDPGGGGLAYAAYANGLGAQLPGLQS
SDTSGSSSSSSSSSSSSSSSSGLRRKGSRDCSVCFESEVIAALVPCGHNLFCMECANRIC
EKSEPECPVCHAAVTQAIRIFS
Download sequence
Identical sequences G5BEZ6
HGL_H00000329918-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]