SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000330161 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000330161
Domain Number 1 Region: 380-714
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.86e-83
Family Ankyrin repeat 0.0000024
Further Details:      
 
Domain Number 2 Region: 7-237
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.27e-55
Family Protein kinases, catalytic subunit 0.0000937
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000330161
Sequence length 734
Comment RIPK4 (Homo_sapiens) receptor-interacting serine-threonine kinase 4
Sequence
MLRAHPSARERLELLEEAKKMEMAKFRYILPVYGICREPVGLVMEHMETGSLEKLLASEP
LPWDLRFRIVHETAVGMNFLHCMSPPLLHLDLKPANILLDAHYHVKISDFGLAKCTGLSH
SHDLSMDGLFGTIAYLPPERIREKSRLFDTKHDVYSFAIVIWGVLTQKKPFADEKNILHI
MVKVVKGHRPELPPVCRPRPRACATLLRLMQRCWHEDPQERPSFQEITSETEDLCEKPEE
EVKETPRDPGGESTPEPKSEAVPGAARLKRASAPPFDNDCSLSELLSQLDSGISQTLEGP
EELSRSSSEHKLQSSSSGKRLSGVSSVDSAFSSRGSLSLSFEREPSASDLGTTDVQKKKL
VDAIVSGDTSRLMKILQPQDVDLVVDGSASLLHLAVEAGQEECVKWLLLNNANPNLTNRK
GSTPLHVAVERRARAVVELLLARKSSVNTKDEDQWTALHFAAQNGDESSTRLLLERNASV
HEVDFEGRTPMHVACQHGQENIVRILLRRGVDVGLQGKDAWVPLHYAAWQGHLAIVKLLA
RQPGASVNAQTLDGRTPLHLAAQRGHYRVARVLIDLCSDVNVRSLQALTPLHVAAETGHT
STARLLLHRGAGKEAVTAEGCTALHLAARSGHLATVRLLLEAKANVLARGPLHQTALHLA
AAHGHSEVVEALVSADLIDLPDAQGLSALHLAAQGHHACTVETLLRHGAHINLQSLKFQG
GHGSAAAVLQCSKT
Download sequence
Identical sequences G5BK30
HGL_H00000330161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]