SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000330289 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000330289
Domain Number 1 Region: 3-123
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 1.96e-33
Family TRAPP components 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000330289
Sequence length 127
Comment TRAPPC6B (Homo_sapiens) trafficking protein particle complex 6B
Sequence
MADEALFLLLHNEMVAGVYKSAEQGEVENGRCITKLENMGFRVGQGLIERFTKDTARFKD
ELDIMKFICKDFWTTVFKKQIDNLRTNHQYLAFTCGLIRGGLSNLGIKSIVTAEVSSMPA
CKLSSHF
Download sequence
Identical sequences G5C813
HGL_H00000330289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]