SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000330805 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000330805
Domain Number 1 Region: 254-294,322-508
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.25e-32
Family beta 1,4 galactosyltransferase (b4GalT1) 0.015
Further Details:      
 
Weak hits

Sequence:  HGL_H00000330805
Domain Number - Region: 55-98
Classification Level Classification E-value
Superfamily Tropomyosin 0.0589
Family Tropomyosin 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000330805
Sequence length 525
Comment CSGALNACT1 (Homo_sapiens) chondroitin sulfate N-acetylgalactosaminyltransferase 1
Sequence
VTMVRRGLLGWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLGLPRANGPHXAALQERE
EQHRNYVSSLKRQIAQLKEELQGRSEQLRGAQDQASEAAGRGPDPKAQAQADLLTFLRAQ
ADKAEVHAGVKLATEYAAVPFDSFTLQKVYQLETGLTRHPEEKPARKDKRDELVEAIESA
LESLNSPSESGPNQRPYTASDFIEGIYRTEKDKGTLYELTFKGDHKHEFKRLVLFRPFGP
IMKVKKEKLNLASTLINVIVPLAKRADKFRQFMQNFREMCIQQDGRIHLTVVYFGKEEMN
EVKGILENTSKAANFRNFTFIQLNGEFSRGKGLDVGARFWKGSNVLLFFCDVDIYFTSEF
LNTCRLNTQPGKKVFYPVLFSQYNPGIIYGHHDAIPPLEQQLVIKKETGFWRDFGFGMTC
QYRSDFINIGGFDLDIKGWGGEDVHLYRKYLHSNLIVVRTPVRGLFHLWHEKRCVDELTP
EQYKMCMQSKAMNEASHGQLGMLVFRHEIEAHLRKQKQKISSKKT
Download sequence
Identical sequences HGL_H00000330805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]