SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000331039 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000331039
Domain Number 1 Region: 397-453
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-24
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 2 Region: 228-285
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.22e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 340-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-23
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 4 Region: 536-593
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.23e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 285-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.45e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 6 Region: 480-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 7 Region: 578-630
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-19
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 8 Region: 185-229
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000108
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 9 Region: 443-475
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000358
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 10 Region: 1-28
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000116
Family KRAB domain (Kruppel-associated box) 0.01
Further Details:      
 
Weak hits

Sequence:  HGL_H00000331039
Domain Number - Region: 159-187
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0158
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number - Region: 96-141
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0289
Family C2HC finger 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000331039
Sequence length 648
Comment ZNF12 (Homo_sapiens) zinc finger protein 12
Sequence
MLENYNNLVSVGCHIIKPDVIIKLEQGEEPWIVEGAFPPQSYPDEAWQADDLMERVQQDA
DMFFINKTLVEERGNVSGKAFNAKMSPVPSRKIASKCDACEKSLTSVSEYISSDGSYAKM
KPDECSGCGKSLLHVKLEKTHPGDEYGGTYTINEESIYQKVRILEKPFEYIECQKAFQKD
SVFVNHMGEKPYNWNESEIAFLQMSDLSGHQRSHVDMKSYECRECGKSFCKKSKFIIHQR
THTGEKPYKCNQCGKSFCQKGTLTVHQRTHTGEKPYECNECGKNFYQKLHLIQHQRTHSG
EKPYECGYCGKSFCQKTHLTQHQRTHSGERPYVCHDCGKTFSQKSALNDHQKIHTGVKLY
KCSECGKCFCRKSTLTTHLRTHTGEKPYECNECGKFFSRLSYLTVHYRTHSGEKPYECAE
CGKTFYLNSALLRHQRVHTGEKPYECSECGKLFSQLSYLTIHHRTHSGVKPYECSECGKT
FYQNSALCRHRRIHRGEKPYECYICGKFFSQMSYLTIHHRIHSGEKPYECSECGKTFCQN
SALNRHQRTHTGEKAYECYECGKCFSQMSYLTIHHRIHSGEKPFECNECGKAFSRMSYLT
VHYRTHSGEKPYECTECGKKFYHKSAFNSHQRIHRRGNVSVVDVGQLL
Download sequence
Identical sequences G5BF49
HGL_H00000331039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]