SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000331242 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000331242
Domain Number 1 Region: 3-99
Classification Level Classification E-value
Superfamily Kringle-like 1.04e-26
Family Kringle modules 0.00082
Further Details:      
 
Domain Number 2 Region: 187-294
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.1e-24
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000331242
Sequence length 466
Comment KREMEN1 (Homo_sapiens) kringle containing transmembrane protein 1
Sequence
MTAECFTANGADYRGTQNWTALQGGKPCLFWNETFQHPYNTLKYPNGEGGLGEHNYCRNP
DGDVSPWCYVAEHEDGVYWKYCEIPACQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQTC
ISFCRSQRFKFAGMESGYACFCGNNPDYWKYGEAASTECNSVCFGDHTQPCGGDGRIILF
DTLVGACGGNYSAMTSVVYSPDFPDTYATGRVCYWTIRVPGASHIHFNFTLFDIRDSADM
VELLDGYTHRVLVRFNGRNRPSLSFNVSLDFVILYFFSDRINQAQGFAVLYQAIKEEVLQ
ERPTVNQTLAEVITEQANLSVSAAHSSKVLYVITTSPSHPPQSVPGWTVYGLATLLILTV
TAIVAKILLHITFKAHRVPASGDLRDCRQPGPSGEIWSIFYKPSTSISIFKKKLKGQSQQ
DDRNPLTEKGHHAAGQQNPDSSCFISYTWERDSKPSTWPSLRLSLV
Download sequence
Identical sequences G5APX8
HGL_H00000331242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]