SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000331342 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000331342
Domain Number 1 Region: 20-131
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000018
Family PLC-like (P variant) 0.048
Further Details:      
 
Domain Number 2 Region: 1097-1128
Classification Level Classification E-value
Superfamily Eferin C-derminal domain-like 0.0000000000379
Family Eferin C-derminal domain-like 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000331342
Sequence length 1137
Comment RAB11FIP1 (Homo_sapiens) RAB11 family interacting protein 1 (class I)
Sequence
MSLAASAGRGLGAVWSPTHVQVTVLQARGLRAKGPGGTSDAYAAIQAVPAAAATLQLTVL
HRALLGLDKFLGRAEVDLRELHRDQGRRKTQWYALKSKPGKKEKERGEIEVDIQFMRNNM
TASMFDLSMKDKSRNPFGKLKDKIKGKHKDSASDTASAIVPSSTPSVDSDDESFSKDKKK
KSKVKTLFSKSNLQKTPLSQSMSVLPISKSDRVLLRPGDFRSQWEDDDQEDESSSSASDI
MSHKRTVSMDPKQLNQINFSLPKKEGLSFLGGLRSKNDTLSRSNVCINGNHVYVEQPEAR
TETKDSSPASSPSPQGFRKKHLFSSSENLAARACKEPGEGKKDVVKGSEGARTTAVPGKE
KEGVLSETRPPEEVFVRGSEKDVVAYTSRQGHSLNPFEDVPISEPEAGPESKSNPKPPAP
SARTPQTKAVKPRLEVSSEAQPKARLPSSPDSSVFFSTIPSSSGQAPGPSELGHGSESQS
SESPSVFSSFPSPIAAPISTSTPVGHWPSSGQGQASLLLQADLQKESLTPVPNTGSSALG
PLFKQPPTPVWKGTGRPSRENADWTEPGSSLLEQPGVGQREEVLLDAPSPKQGCTLSAGD
TPEELSAVSLGGGRIVDPTGKLPMEGHADLESHPRPSAQSRVTGARMSSTVKEVAVPLPA
DELAPLPDSLMQKQEEMNLNGGQGQKKGKKRVSFSEQPFTEEVEKPTGLGEDDKNHPQEL
TLEGATMEGASGTDPAGCLHSEDAERERITVPAAIEGGSVVPSHAESSSGGLRSKVSLAK
HTPLFRIEGIDTFTSQYQSKASDHEGSQSDPLSVFPSASEMTPPMVADLNLTLPSIPEVA
SDDERVDQVEDGGKTAGASSWSTWPPHPKQAEGLSGRTDGAVLAESLHGFSSLVSAASPS
EQKAALGIDKPHLVKGTNKDEQLPGPGGDEEEKPKAGRSPGHPPGLSPHSPVPSPSLSET
FPATHSSPHADAHHTSTAESLKKATAEGSTGKVENFGKRKPLLQAWVSPSETHPVSAQPG
AGTGAAKHRLQPVKPMNTTATKISNSSLGMATIISENVTSDAMIKKYSPSDPAFAYAQLT
HEELIQLVLKQKETISKKEFQVRELEDYIDNLLVRVMEETPNILRIPAPVGKKAGKM
Download sequence
Identical sequences G5B0A0
HGL_H00000331342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]