SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000331465 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000331465
Domain Number 1 Region: 431-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.41e-27
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 235-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.14e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 487-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 543-600
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.63e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 599-656
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.82e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 375-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 7 Region: 291-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.42e-22
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 8 Region: 641-693
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.94e-20
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 9 Region: 180-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.46e-18
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 10 Region: 141-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000198
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 11 Region: 338-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000126
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 12 Region: 1-28
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000288
Family KRAB domain (Kruppel-associated box) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000331465
Sequence length 702
Comment ZNF84 (Homo_sapiens) zinc finger protein 84
Sequence
MLENYSSLVSLGYTVMKPDVIFKLEQGEEPWVGDGEVQHSDCPEAWQVDDHMTWQQENQD
QPRSLKRGHEWDVFGKNFTLNMDFVSLSKSNNEGDLDGLILEHHLDLLIPEADCGRESDD
FNVFDKLFLNTKPQEADTWLKYYECDKCDNINYKKSQIVIYHRTRLGEKLYECSECRKRF
SKKSSLIKHQSRHIREIAYGCGKCGKTFPQKSQFVTHHRTHTGEKPYDCGQCGKAFSQKS
QLTSHQRTHTGEKPYECGKCGKAFSRKSHLISHWRTHTGEKPYGCSECGRAFSEKSNLIN
HQRIHTGEKPFGCRECGRAFSRKSQLVTHHRTHTGTKPYGCSDCRKAFFEKSELIRHQTV
HTGEKPYECRECGKAFRERSSLINHQRTHTGEKPHGCLQCGKAFSQKSHLISHQMTHTGE
KPFVCSKCGKAFSRKSQLVRHQRTHTGEKPYECSECGKAFSEKLSLTNHQRIHTGEKPYV
CSECGKAFCQKSHLISHQRTHTGEKPYECTECGKAFGEKSSLATHQRTHTGEKPYECRDC
DKAFSQKSQLNTHQRIHTGEKPYECTLCRKAFFEKSELIRHQRTHTGEKPYECSECRKAF
REKSSLINHRRIHTGEKPFECRECGKAFSRKSHLIPHQRTHTGERPYGCSECRKAFSQKS
QLVNHQRIHTGEKPYQCIECERAFSQKSQLINHQRNHTGPKS
Download sequence
Identical sequences G5ANV0
HGL_H00000331465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]