SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000331602 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000331602
Domain Number 1 Region: 345-668
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.46e-86
Family Protein kinases, catalytic subunit 0.000000000931
Further Details:      
 
Domain Number 2 Region: 1-122
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.36e-25
Family PLC-like (P variant) 0.000001
Further Details:      
 
Domain Number 3 Region: 217-284
Classification Level Classification E-value
Superfamily Cysteine-rich domain 8.67e-23
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000888
Further Details:      
 
Domain Number 4 Region: 141-210
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.13e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000331602
Sequence length 696
Comment PRKCD (Homo_sapiens) protein kinase C, delta
Sequence
MAPFLRIAFNSYELGSLQAEDEASQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFD
AHIYEGRVIQIVLMRAAEEPMSEVTVGVSVLAERCKKNNGKAEFWLDLQPEAKVLMSVQY
FLEDGDCKQSMRSEEDGKFPTMNRRGAIKQAKIHCIKNHEFIATFFGQPTFCSVCKEFVW
GLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTATNSRDTIFQKERFNIDMPHRFKVYTYMS
PTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVSQRSSR
KQDTGSSEPVGIYQGFEKKPGVFGDDAPDNGTYGKIWEGSTRCRIENFTFHKVLGKGSFG
KVLLAELKGKGQFFAVKALKKDVVLIDDDVECTMVEKRVLALAWENPFLTHLFCTFQTKE
HLFFVMEFLNGGDLMYHIQDKGRFELYRATRAVTAEPGVWPQTGTVALLTGFYAAEIICG
LQFLHNKGIIYRDLKLDNVMLDREGHIKIADFGMCKENVFGENRASTFCGTPDYIAPEIL
QGLKYTFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESRDVLE
KLFERDPVKRLGMTGNIKIHPFFKTINWPLLEKRKVEPPFKPKVKSSGDYNNFDQEFLNE
KPRLSHSDKNLIDSMDQTAFAGFSFVNPKFEHLLEA
Download sequence
Identical sequences G5BUN9
HGL_H00000331602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]