SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000331626 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000331626
Domain Number 1 Region: 41-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.7e-34
Family SCAN domain 0.0000932
Further Details:      
 
Domain Number 2 Region: 840-896
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 784-840
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-22
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 4 Region: 881-933
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000183
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 5 Region: 736-784
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000794
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 6 Region: 227-286
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000418
Family KRAB domain (Kruppel-associated box) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000331626
Sequence length 964
Comment ZKSCAN2 (Homo_sapiens) zinc finger with KRAB and SCAN domains 2
Sequence
MAAALNSQISMPLEVEGCVMLKVEKDPEWASEPFLEGSDSTECETFRKCFRQFCYEDVTG
PHEAFSKLWELCCRWLKPEMRSKEQMLELLVIEQFLTILPKKIQAWAQRQCPESGEEAVA
LVVHLEKETGRFRQQVSSPIHSEKQAPLGTVWEVVDFQPEQVDTQPRVVSREEAGSLHSG
HQEQLNQKREHRPLPRNARSSPWVPAPADEWNTVDQEVTTTHLPAGSQEPVKDVHVLRGF
SHKKTVHQIPVHRDLYREIRKENVGNTVSLGNTVSPSNKIARLEQRKEPWTVGLHSSNKR
NVLRSAYVKEKSAHPVQIPARNARKIWRDQQQWGVEDEKIAGVHWSYEETKTFLAILKES
RFYETLQACPRNSQVYGAVAEWLRECGFLRTPEQCRTKFKSLQKSYRKVRNGHMLEPCAF
FEDMDALLNPAAHASSTDKPKEIVSLPRLKRIGISAKEQITLVEEEAAEESDDDEMGIEF
IHKPEVHGAPVLFQNLSGVHWGYEETKTFLDILHETRFYEALQACHRKSKLYGAVAEQLR
ECGFLRTPEQCRTKFKSLQKSYRKVKNGHVLESCAFYKEMDALINFHASAPSTDSSEEVL
SASRHERGPTEVEPQEPTGWEPENSQEAVIEDSSSERMSEEEVLQEQEFQGPPGLLQSPN
DFEIGSSIKEDPTQVIYKDPEPHRALIEKSKRVVSQNTDPSRYRKRECISGRQWENLQSI
RQGKLMAQPRDLGKAVMHQRPFLGRRPYRLLRYGESFGRSARLMCRMTHQKENPYKCSVC
GKCFGRSRSLIRHQRIHTGEKPFKCLDCGKSFNDSSNFGAHQRIHTGEKPYRCGECGKCF
SQSSSLIIHQRTHTGEKPYQCGECGKSFTNSSHFSAHRRVHTGENPYKCMDCEKSFNNCT
RFREHRRIHTGEKPYGCAHCGKRFGKSSVLAKHREVHVREKLLPHPLSMYPPEKGKTDDF
RKTF
Download sequence
Identical sequences G5B942
HGL_H00000331626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]