SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000331691 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000331691
Domain Number - Region: 87-148
Classification Level Classification E-value
Superfamily Tropomyosin 0.0471
Family Tropomyosin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000331691
Sequence length 150
Comment C12orf60 (Homo_sapiens) Uncharacterized protein C12orf60
Sequence
MCSVAEKCINVELPHSAKGLFSDIQTPVIVSGLRSSNIFESLESLLSLLMTFPVMNLRLS
DFYREDTKEQSDATTSGKTMSPDLSKTTTKDTLKKLQDALKTENTSNPRESAADHLEQIL
KVMEPTLYILQKAIKTVETDISKSKKVIDK
Download sequence
Identical sequences G5BV50
HGL_H00000331691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]