SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000332124 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000332124
Domain Number 1 Region: 281-422
Classification Level Classification E-value
Superfamily C-type lectin-like 3.21e-41
Family C-type lectin domain 0.00028
Further Details:      
 
Domain Number 2 Region: 866-1016
Classification Level Classification E-value
Superfamily C-type lectin-like 5.74e-41
Family C-type lectin domain 0.00026
Further Details:      
 
Domain Number 3 Region: 577-711
Classification Level Classification E-value
Superfamily C-type lectin-like 1.27e-38
Family C-type lectin domain 0.000000301
Further Details:      
 
Domain Number 4 Region: 721-859
Classification Level Classification E-value
Superfamily C-type lectin-like 7.26e-38
Family C-type lectin domain 0.00025
Further Details:      
 
Domain Number 5 Region: 1154-1292
Classification Level Classification E-value
Superfamily C-type lectin-like 1.69e-36
Family C-type lectin domain 0.0002
Further Details:      
 
Domain Number 6 Region: 434-570
Classification Level Classification E-value
Superfamily C-type lectin-like 5.06e-32
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 7 Region: 1024-1147
Classification Level Classification E-value
Superfamily C-type lectin-like 1.38e-30
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 8 Region: 161-275
Classification Level Classification E-value
Superfamily C-type lectin-like 2.36e-29
Family C-type lectin domain 0.00082
Further Details:      
 
Domain Number 9 Region: 87-145
Classification Level Classification E-value
Superfamily Kringle-like 1.17e-19
Family Fibronectin type II module 0.00069
Further Details:      
 
Domain Number 10 Region: 2-87
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.61e-19
Family Cysteine rich domain 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000332124
Sequence length 1389
Comment MRC1L1 (Homo_sapiens) mannose receptor, C type 1-like 1
Sequence
MSVAFKLCLGVPSKSDWVPVTLYPCNSQSEIQKWECKNDTLLGIKGEDLYFNYGNKQEKN
IMLYKGSGLWSRWRIYATTDDLCSRGYEAMYTLLGNANGAPCAFPFKFENKWYADCTNAG
RSDGWLWCGTTTDYDSNKLFGFCPTKSEDKLWTKDPLTSILYQINSKSALTWQQARKSCQ
QQDAELLSITEIHEQTYLTGLTSSLTSGLWIGLNSLSFNSGWQWSGSSPFRYLNWLPGSP
SAEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNSTLNSFIIPSETDVPSSCPSQWWL
YAGQCYKIHREVKKIQRDALTACRKEGGDLASIHTIEEFDFIISQLGYEPSDELWIGLND
IKIQMFFEWSDGTPVTFTKWLRGEPSHENNRQEDCVVMKGKDGFWADRACEEPLGYICKK
KAQAQAPGTVEKEAGCRRGWKRHGFYCYLIGNTLSTFTEANQTCNNEKAYLVTIEDRYEQ
AFLTSLVGLRPEKYFWTGLSDVQIKGTFQWTVQEEVQFTHWNADMPGRKAGCVAMKTGIA
GGLWDVLKCDQRAKFVCKHWAEGVTRPPEPTTTPEPKCPEDWGTTSKTSSCFKLFAKGKH
EKKTWFESRDFCRALGGELATIKSKEEQQTIWRLITSTGSYHELFWLGLTYGGTSEGFAW
TDGSPVSYENWAYGEPNNYNNVEYCGEMKGDPNMSWNDINCEHLNNWVCQIQKGKTPNPE
PTPAPQENPPVTEDGWVIYKDYQYYFSKQKENMDNARAFCKRNFGDLVTVKSESEKKFLW
KYVNRKGAPSMSAYFIGLLISLDKTFIWMDGSKVDYVSWAPGEPNFANEDENCVTLYTDS
GLWNDINCGYPNPFICQRHNSSINATAVPTTPPTPGGCKEGWKFYNNKCYKIFGFVEEDK
KNWQEARKACIGFKGNLASVLNEKEQAFLVSHMKESTFNAWIGLNDVNSEHKFLWTDGRG
VDYTNWGKGFPGGRRSSLSYEDADCVVIVGGKIRDAGKWMDDVCDSKKGYVCQTLPDPSL
PNSPTTAPAGGFIKYGGSSYSLMKNKLTWDEAEKYCKSYTSLIASILDPYTNAFLWLKMQ
PFNVPVWIGLNSNLTNNDYTWIDKWRMRYNNWAVNEPRVKSACVYLDVDGFWKTSYCNET
FYFLCKRSDEIPATEPPQLPGRCPESEVNAWIPFHGHCYYIESSFTRNWGQATLECLRMN
SYLVSIENAAESSFISYLVEPLRSKTNFWIGLFRNVEGKWFWINNSPLSFVNWNSGEPST
ERNDCVALTASTGLWTNIHCSSYKGFICKRPKIIDPEPTHTLITTKADSRKMEPSKKSSS
TAGVLVVVVLLIVMSAGLAAYYFYRKRRAQLPPETTFENTLYFNSHSSPGTSDTKDLMGN
IEQNEHAVI
Download sequence
Identical sequences G5BFE0
HGL_H00000332124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]