SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000332433 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000332433
Domain Number 1 Region: 11-101
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.11e-36
Family SCAN domain 0.000084
Further Details:      
 
Domain Number 2 Region: 268-325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.93e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 324-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-19
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 366-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.65e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 215-269
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.32e-18
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000332433
Sequence length 428
Comment ZSCAN22 (Homo_sapiens) zinc finger and SCAN domain containing 22
Sequence
GLQLQGNSKGLGQEPLCKQFRQLRYEETAGPREALRRLRELCHQWLQPETHSKEQILELL
VLEQFLAILPEELQARVQEKHPESGEDLVVVLEDLQLELGGKGHQEAPDQDKKQALLLEA
PGPLRAVQAQQVLPGCEGPKPEEEEDEEIHIGNGKLVMTDPCGTEESSRKEADPREAQYE
DSNLERQPGKPQDSDLTEFRSTRPEGKLCDSEVCQSSALPGHQKSHLKEKGHQCHECGKV
FQRSSHLVRHQKIHLGEKPYQCKECGKVFSQNAGLLEHLRIHTGEKPFLCIHCGKNFRRS
SHLNRHHRIHSQEEPCECKECGKTFSQALLLTHHQRIHSHSKSHRCNECGKAFSLTSDLI
RHHRIHTGEKPFKCKVCQKAFRLNSHLDQHIRIHNEEKPYKCTECGDAFRQKSGLFQHQR
HHHRGRLA
Download sequence
Identical sequences G5BSH0
HGL_H00000332433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]