SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000332444 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000332444
Domain Number 1 Region: 9-98
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9e-31
Family Canonical RBD 0.00000752
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000332444
Sequence length 642
Comment CSTF2T (Homo_sapiens) cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa, tau variant
Sequence
MSSLSVRDPAMDRSLRSVFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYG
FCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGPAAPIIDSPYGDPID
PEDAPESITRAVASLPPEQMFELMKQMKLCVQNSHQEARNMLLQNPQLAYALLQAQVVMR
IMDPEIALKILHRKIQVTPLIPGKSQSVSGPGPVSGPGPVSGSGPVSVSGPGPGPGLCPG
PNVLLSQQNPPAPQPQHLARRPVKDIPPLMQTPIQGGIPAPGPIAVTVPGPGPGPGSLTP
GGAMQPQVGMPGVGPVSLERGQVQMADPRAPIPRGPMSAAGLPPRGLLGDAPNDPRGGTL
LSVTGEVEPRGYLGPPHQGPPIHHASGHDNRGPSAHDMRGGPIADARLLIGDPRGPMMDQ
RGLPMDGRGGRESRGMDTRAMETDVLETRVMERRGMETCAMETRGMEARGMDARGLEMRG
PGPSSRGAMTGGIQGPGSINIGAGGPQGLRQVPSISGVGNPGGMQGAGMQGAGMQGAGMQ
GAGMQGGGMQGGGIQGGGIQGGGMQAASIQGVGIQGGSKQGGGQPSSFSPGQSQVTPQDQ
EKAALIMQVLQLTADQIAMLPPEQRQSILILKEQIQKSTGAS
Download sequence
Identical sequences G5CAC2
HGL_H00000332444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]