SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000332806 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000332806
Domain Number - Region: 513-640
Classification Level Classification E-value
Superfamily Tropomyosin 0.00608
Family Tropomyosin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000332806
Sequence length 699
Comment EMILIN3 (Homo_sapiens) elastin microfibril interfacer 3
Sequence
PCRALCAYVVHRNVTCILQEGAESYIKAEFRQCGWGPKCPGTVTYRTVLRPKYKVGYRTV
TDLTWRCCPGLTGERCPEHLTDHGATPPQLNPEAQVPSGQAGSGPRPPAYSQVAPGPHGR
KGLGLLGERLGRLEGDVQRLAQVYSTLSGLVASHEDPNRITGDSRAPAAPVGLGVFPEGH
VDPGDRAGGPLTAPLGEILSKLTEVSNTLRSKVQLLDEVHGLALSHEAHLQQLREAPPSP
LTSLALLEEYVDQRLQRLWGSLLGGFEQKLQGIQSECDLRVREVRQQCEEGQAASQQLHQ
SLDGRELALRRELSQLGTQLQGLSVAGGASCCGQLALISARVDNLGKNLRAVVEAHKGPG
TSARDELEHLSAAMIEGGVDGLLEGLETLNGTENGASSCCLRMELGSWGVEDRLATLIGE
LNQDSIPLGRSVRPLVPTELAVLEQRLVSLETSCTPSTTSATLDNLVSEVKAWQSRSETL
LHQVASHTALLQQLNGTVAEVQGQLAGGTGSSLQGEITLLKVNLNSVSKSLTGLSDSVSQ
YSDAFLAANTSLDERERKVEAEVHAIQDQVSSQGSRLRAGHRQVLNLQGELAQLKAGMAN
VARGLSRCQDTTRELQRAVGHFDQRVAQVEGMCRRLGLLAASLDSLPTEPLRSREGLWGH
VDQLNRTLAQHTEDIAHLRDDLLDCRAQLAEQVRLGQAD
Download sequence
Identical sequences G5BCX3
HGL_H00000332806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]