SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000333001 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000333001
Domain Number 1 Region: 63-173
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.35e-29
Family Canonical RBD 0.0000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000333001
Sequence length 174
Comment RBM8A (Homo_sapiens) RNA binding motif protein 8A
Sequence
MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQD
GDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVE
YETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR
Download sequence
Identical sequences A0A023T787 A0A091DL65 A0A096NP76 A0A0D9S5W1 A0A1S3AQ17 A0A1S3FBZ6 A0A1U7QR19 A0A1U7U2B1 A0A212CGY1 A0A250YB83 A0A2I2ZK34 A0A2I3I026 A0A2K5BW41 A0A2K5K7D7 A0A2K5L2N9 A0A2K5R055 A0A2K5ZQ39 A0A2K6DEX1 A0A2K6G648 A0A2K6QXG9 A0A2K6UDV2 F6XAE9 F6XEW8 F7DRZ4 G1PWV5 G5BBN0 G7NTP9 H2N623 H2PZT9 H9ZG30 I3LI59 L5K368 L5LUW5 L9JGP5 M3XNX3 Q27W01 Q3ZCE8 Q9CWZ3 Q9Y5S9 S7Q7Q3 S9YRT0
ENSMUSP00000044548 10090.ENSMUSP00000044548 10116.ENSRNOP00000028807 9544.ENSMMUP00000021116 9598.ENSPTRP00000002050 9600.ENSPPYP00000001082 9606.ENSP00000333001 9796.ENSECAP00000019548 9823.ENSSSCP00000007127 ENSP00000463058 ENSP00000333001 ENSP00000462894 ENSRNOP00000028807 ENSMMUP00000021116 5xjc_w 5yzg_w ENSFCAP00000022727 ENSECAP00000019548 ENSNLEP00000007006 ENSPTRP00000002050 ENSSARP00000012000 ENSPPYP00000001082 ENSMLUP00000015899 ENSPPYP00000001082 HGL_H00000333001 ENSECAP00000019548 ENSSARP00000012000 ENSCJAP00000003980 ENSRNOP00000028807 ENSCJAP00000003980 ENSMMUP00000021116 NP_001095877.1.92730 NP_001157445.1.31192 NP_001258067.1.100692 NP_001258067.1.4139 NP_005096.1.87134 NP_005096.1.92137 XP_001162472.1.37143 XP_001927895.1.46622 XP_002715691.1.1745 XP_002759858.1.60252 XP_002810362.2.23681 XP_002924609.1.58354 XP_003268146.1.23891 XP_003498665.1.69978 XP_003793826.1.62490 XP_003806237.1.60992 XP_003944429.1.74449 XP_003990593.1.62641 XP_004026531.1.27298 XP_004285836.1.21590 XP_004398438.1.74151 XP_004420622.1.5094 XP_004619279.1.94378 XP_004647901.1.9945 XP_004659156.1.11716 XP_004689638.1.23501 XP_004779709.1.14098 XP_004853973.1.39548 XP_005084293.1.91757 XP_005357100.1.66349 XP_005413481.1.28644 XP_005885013.1.60319 XP_005898583.1.15283 XP_005958115.1.78601 XP_006040978.1.26621 XP_006096938.1.53796 XP_006157191.1.99106 XP_006172804.1.101512 XP_006212504.1.17985 XP_006751851.1.47382 XP_006764220.1.95426 XP_006919771.1.64745 XP_006982647.1.50099 XP_007092616.1.5354 XP_007130832.1.24612 XP_007182233.1.59432 XP_007459413.1.90284 XP_007538750.1.11023 XP_007608975.1.28591 XP_007975473.1.81039 XP_008064225.1.4292 XP_008151360.1.99482 XP_008526460.1.77740 XP_008577608.1.73410 XP_008705978.1.72690 XP_010372739.1.97406 XP_010627815.1.5607 XP_010966533.1.22495 XP_010998009.1.51371 XP_011364386.1.92234 XP_011735144.1.29376 XP_011806687.1.43180 XP_011850555.1.47321 XP_011850556.1.47321 XP_011930802.1.92194 XP_012013770.1.54773 XP_012327381.1.9421 XP_012355810.1.23891 XP_012498896.1.63892 XP_012617409.1.48125 XP_012873775.1.60039 XP_013817917.1.57651 XP_014722538.1.49734 XP_014939734.1.86478 XP_015005630.1.72884 XP_015306827.1.63531 XP_015318708.1.76553 XP_015998487.1.101085 XP_016057890.1.3490 XP_017370658.1.71028 XP_017521233.1.32401 XP_017730339.1.44346 XP_019292109.1.44245 XP_019775377.1.83887 XP_019812220.1.53367 XP_020013043.1.5219 XP_020759973.1.74333 XP_021051923.1.100879 XP_021483829.1.76796 XP_021543753.1.83697 XP_533035.1.84170 ENSMLUP00000015899 gi|4826972|ref|NP_005096.1| ENSMPUP00000000773 ENSPTRP00000002050 ENSPVAP00000013640 ENSP00000333001 ENSP00000463058 ENSNLEP00000007006 ENSCAFP00000016512 ENSCAFP00000016512 ENSMUSP00000044548 ENSMPUP00000000773 ENSMUSP00000044548 ENSPVAP00000013640 ENSPANP00000014800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]