SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000333170 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000333170
Domain Number 1 Region: 4-97
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.55e-25
Family Canonical RBD 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000333170
Sequence length 245
Comment RBM11 (Homo_sapiens) RNA binding motif protein 11
Sequence
MFPTQEEADTTVFVGNLEARVREEILYELFLQAGPLTKVTICKDREGKPKSFGFVCFKHP
ESVSYAIALLNGIRLYGRPINVQYRFGSSRSSEPANQSFESCVKINSHSYRNEEVVGRSS
FPMHVFPINNTDLPQEYFFFQKMMSVFFSLQWHTHNPLLQLPYYEMTAPLPNNTSGSSAL
SHVPEPEAGPSSYEWTPQQPSDCNHYQMNKRKRQKQASDSDSSTENNRGNEYNQKFRKYK
KKKRY
Download sequence
Identical sequences G5B4Q3
HGL_H00000333170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]