SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000333192-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000333192-1
Domain Number 1 Region: 187-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.58e-25
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 299-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 243-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.51e-23
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 4 Region: 341-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.53e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 1-52
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.28e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 6 Region: 135-188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000655
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000333192-1
Sequence length 402
Comment ZFP1 (Homo_sapiens) zinc finger protein 1 homolog (mouse)
Sequence
QVSVSFTDVTVDFTQEEWEQLDPSQRILYMDVMLENYSNLLSVEVWKADDQMEREHRNPD
EQARQFTVLKNQTPFEERGNLFGKTFNLNTEFVSLRQVPYKYDLYEKTLKYNSDLLNNNS
YATKKGDECTGFGKPLLYLKQEKTHLGAEYSEYNKSGKALSHKEVIFKHQKIKNLIQPFI
CNYCDKAFPFKSLLISHKRIHTGEKPYECNVCKKTFSHKANLIKHQRIHTGEKPFECPEC
GKAFTHQSNLIVHQRAHMEKKPYECGDCGKTFAQKFELTTHQRIHTGERPYECNECAKTF
FKKSNLIIHQKIHTGEKRYECSECGKSFIQNSQLIIHMRTHTGEKTYECTECGKTFSQRS
TLRLHLRIHTGEKPYECTECGKAFSSKSQLNVHQRVQIGDRP
Download sequence
Identical sequences G5B5X4
HGL_H00000333192-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]