SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000333433-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000333433-2
Domain Number - Region: 30-110
Classification Level Classification E-value
Superfamily tRNA-binding arm 0.0492
Family Seryl-tRNA synthetase (SerRS) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000333433-2
Sequence length 141
Comment SKA2 (Homo_sapiens) spindle and kinetochore associated complex subunit 2
Sequence
MLQKADSDLGYIQYRLECEIKTNHPDSAVEKNPVTLLKELSAIKSRYQTLYAHFKPIASE
QKETKSRIYTTLNKTMAMIQELQKHTDVELSSLTEEEKTVTEQLKSHMPHLRRSGIAKGN
CNYEEINSREKQEDVSLTVHE
Download sequence
Identical sequences G5BEG9
HGL_H00000333433-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]