SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000333725 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000333725
Domain Number 1 Region: 9-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.4e-23
Family KRAB domain (Kruppel-associated box) 0.00089
Further Details:      
 
Domain Number 2 Region: 126-183
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.57e-23
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 3 Region: 182-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 238-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.82e-22
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 280-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.74e-21
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 88-140
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.71e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000333725
Sequence length 344
Comment ZNF26 (Homo_sapiens) zinc finger protein 26
Sequence
MAVSFRTASCWGLLSFKDVSMEFSWEEWQLLDSTQRHLYREVTLENYSNLLSVGYHGTKP
ELIFKMEQGEEPWIINAKMSTPSCAGVKPYECGECGKAFSLKSPFVVHQRTHTGVKPHKC
NECGKAFRSKSYLLVHIRMHTGEKPYQCRDCGKAFNMKTQLVVHQGVHTGNNPYQCSECG
KAFGRKEQLTAHLRAHAGEKPYACSECGKAFSSKSYLVIHRRTHTGERPYECSLCERAFC
GKSQLIIHQRTHSSEKPYECSKCEKAYPRKASLQIHQKTHSGEKPFKCSECGKAFTQKSS
LSEHQRVHTGEKPWKCSECGKSFCWNSGLRIHRKTHKGEMQVMK
Download sequence
Identical sequences G5ANV1
HGL_H00000333725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]