SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000333802 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000333802
Domain Number 1 Region: 425-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.18e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 341-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.83e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 285-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.13e-22
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 202-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-21
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 5 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.01e-20
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 6 Region: 467-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.76e-19
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 7 Region: 248-279
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000647
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 8 Region: 388-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000205
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000333802
Sequence length 523
Comment ZNF599 (Homo_sapiens) zinc finger protein 599
Sequence
ALVSFEDVAVTFTGEEWRHLDLTQRTLYQEVMLETCELLVSLGCPVPKAELMYPLEYGQG
LWMVKRGLLQHTCTGEKAKLDTTEPSDSQLVFSKESSYQEQLIQRSSRDSRLGQATHEER
LLEMQEGIVRPGTDLSKETCSGKQSHKHDDLKTSDNLCLRVLQEQVIAQDAIRDHGSEKP
GKDHVIDPKNKPYKCKECGKAFGKNWALTQHQQIHTGVKPYECNECEKAFKRRSHLTEHQ
HIHSTEKPFLCKECGKAFYYSSSIAQHMRIHTGKKLYECTDCGKAFTHRSTFIRHNMTHT
GEKPFICKECGKAFCRNSSFTQHMRIHTGEKPYECSECARAFAHCSTFIRHKRTHKGEKP
FECKECGKAFCDSSSLIQHMRSHTGEKPYECNECGKAFTQHFAFIRHNRSHTGVKPLKCK
ECPKSFSYSSSFIRHMRSHTGEKPYVCKECGKAFLHNRNFIRHYRIHTGEKPFECKECGK
AFCDNFALTQHMRTHTGEKPFACSECGKTFRHSSSFTLHRKIH
Download sequence
Identical sequences G5BXK9
HGL_H00000333802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]