SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000334100 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000334100
Domain Number 1 Region: 86-249,330-717
Classification Level Classification E-value
Superfamily Cullin repeat-like 5.75e-136
Family Exocyst complex component 0.00085
Further Details:      
 
Weak hits

Sequence:  HGL_H00000334100
Domain Number - Region: 10-80
Classification Level Classification E-value
Superfamily Tropomyosin 0.0915
Family Tropomyosin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000334100
Sequence length 720
Comment EXOC7 (Homo_sapiens) exocyst complex component 7
Sequence
MIPPQEASARRREIEDKLKQEEETLSFIRDSLEKSDQLTKNMVSILSSFESRLMKLENSI
IPVHKQTENLQRLQENVEKTLSCLDHVISYYHVASDTEKIIREGPTGRLEEYLGSMAKIQ
KAVEYFQDNSPDSPELNKVKLLFERGKESLESEFRSLMTRHSKVVSPVLILDLISGDEEL
EVQEDVALEHLPESVLQDVVRISLWLVEYGRNQDFMNVYYQIRSSQLDRSIKGLKEHFRK
SSSSSGVPYSPAIPNKRKDTPTKKPIKRPGTIRKAQNLLKQYSQHGLDGKKGGSNLIPLE
GHEHDFRVKHLSEALNDKHGPLPGRDDMLDVETDAYIHCVSAFVRLAQSEYQLLMDIIPE
HHQKKTFDSLIQDALDGLMLEGENIVSAARKAIIRHDFSTVLTVFPILRHLKQTKPEFDQ
VLQGTAASTKNKLPGLITSMETIGAKALEDFADNIKNDPDKEYNMPKDGTVHELTSNAIL
FLQQLLDFQETAGAMLASQVLGDTYNIPLDPRETSSSATSYSSEFSKRLLSTYICKVLGN
LQLNLLSKSKVYEDPALSAIFLHNNYNYILKSLEKSELIQLVAVTQKTAERSYREHIEQQ
IQTYQRSWLKVTDYISEKNLPVFQPGVKLRDKERQMIKERFKGFNDGLEELCKIQKAWAI
PDTEQRDKIRQAQKNIVKETYGAFLHRYSSVPFTKNPEKYIKYRVEQVGDMIDRLFDTSA
Download sequence
Identical sequences G5AQV6
HGL_H00000334100 XP_012933628.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]