SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000334308 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000334308
Domain Number 1 Region: 60-191
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000332
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 2 Region: 620-747
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000489
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 3 Region: 218-328
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000245
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 4 Region: 516-610
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000154
Family Spectrin repeat 0.022
Further Details:      
 
Weak hits

Sequence:  HGL_H00000334308
Domain Number - Region: 442-555
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000302
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 785-826
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.00133
Family SCAN domain 0.0064
Further Details:      
 
Domain Number - Region: 8-74
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0518
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000334308
Sequence length 979
Comment C14orf49 (Homo_sapiens) Nesprin-3
Sequence
MTQQPREGFDRSVQETRAWMQAVQEQLQVNDNTQGPLAALEARLQETEKICRLEPEGQLK
VDLVLQAAETLLACCLEDQRPEILARLRELKDQWEETVTYMTHCHSRIEWVWLHWREYLL
ARDEFYCWFQKMVVMLEPPAELQLGLKEKQWQLSDAQVLLHNVENQAELLDRLLEEAASL
FNRIGDPSVDEEAQRRMKTEFDTVKAKAQNRVDLLARVAQEHEEYQVGVDEFQLWLRALV
EKVQNCVGSRCHLSAELHLSELQDITKDFSQGEESLRRLEAQSACIIQNTSPLGAEKITR
ELEEMRKVLQKRRVLWEAEKAQLQDLLSSKGAGEQRIQWLEAELGEFRKGLQRLAQGGLE
PSATVMTVGTEDELVARWRLYSVSRATLASEEPRVDQLQAQLKELVALPNLQPLCDSVVA
AIQEFKSMKGKSTRLCNATRVALWQCFQRPLHDLQLWRALAQRLLDVTISLPDLPSIHTF
LPQIKAALVESSRLKEQLGSLPLKRDLLGSVFGQERASGLLEQAESCLRDRDLLHSGLLR
RKSKLQSSLAQHKDFGAAFEPLQKKLLDLRARVQAEKGLQPDLPGKKAQLLRLQGLQEEG
LELEMQIEAMRPLVRGDSSHQHKMDQLSSDYRTLHRSLKDRMDRCRQSVQEHCTFSCRLL
ELQQWVTMATRTLESHRGDVGLWNAKSQEASVETLAAELPKKEACLALVEAHGRLVMEKS
SPEGVAMVQEELKELAESWQALQQLEENMLSLIRNRQLQSTEVDSGRKLVFTNNIPKSGF
LINPLDPIPRRRRHRAHLLEEGEGSHEDFSQLQRNFEQWLQVENSKLVRIIAMRATSAKD
RRTREAKLQELQARIPEGQHLLENLLHLGPSRPVSEELEDLRYCWMLYKSQLKDAGHLLM
SLQSHSHPVSVSQVRRAHGPCSLLRKACCLVLWLLLLLLLFLLLLFLLPAGEEALSCTQA
NNFASSFLLMLHYNGPPPT
Download sequence
Identical sequences G5B484
HGL_H00000334308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]