SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000334382 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000334382
Domain Number 1 Region: 1-139
Classification Level Classification E-value
Superfamily PH domain-like 3.58e-49
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000000229
Further Details:      
 
Domain Number 2 Region: 201-339
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000229
Family Tropomyosin 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000334382
Sequence length 352
Comment HOMER1 (Homo_sapiens) homer homolog 1 (Drosophila)
Sequence
EQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTIT
PNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEKME
LTSTPSQESAGGDLQSPLTPESINGTDDERTPDMTQNSEPRAEPTQNALPFSHSSAISKH
WEAELATLKGNNAKLTAALLESTANVKQWKQQLAAYQEEAERLHKRVTELECVSSQANAV
HTHKTELNQTIQELEETLKVKEEEIERLKQEIDNARELQEQRDSLTQKLQEVEIRNKDLE
GQLSDLEQRLEKSQNEQEAFRNNLKTLLEILDGKIFELTELRDNLAKLLECS
Download sequence
Identical sequences G5AST8
HGL_H00000334382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]