SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000334642 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000334642
Domain Number 1 Region: 387-483
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000289
Family PDZ domain 0.037
Further Details:      
 
Domain Number 2 Region: 861-911
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000269
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000334642
Sequence length 1178
Comment PDZD8 (Homo_sapiens) PDZ domain containing 8
Sequence
MSFEVAAHVAPIPLCPGQTNAMDMSDLELEQQFCTCKLSMWSNIRAVRGVALSWLPVDHH
VDTMTIPGCMSDAREPHIKQALRSTHKPRLHHPATPKPPLMLREAALRQLQPQQDHKEVT
ENKDRDVYILGKLRDTALTRRWVTKKIKVEFEELLQTKTAGRLLEGLSLRDVFLGDTVPF
IKTIRLVRPVVASATGEPDGPEGETLPATCPEELAFEAEVEYNGGFHLAIDVDLVFGKSA
YLFVKLSRVVGRLRFVFTRVPFTHWFFSFVEDPLIDFEVRSQFEGRPMPQLTSIIVNQLK
KVIKRKHTLPSYKIRFKPFFPYQTLQGFGEDEEYIHIQHWALTEGRLKVTLLECSRLLIF
GSYDREANIHCTLELSSSVWEEKQRSSIKTVELIKGNLQSVGLTLRLVQSTDGYAGHVII
ETVAPNSPAAIADLQRGDRLIAIGGVKITSTLQVLKLIKQAGDRVLVYYERPVGQSNQSV
VLQDNFGQLEETFLSSSCQPSYEEEAAGLAVDAENRDLDSEYEDLASDVRVQNEFKDEGQ
SLSHSPKRTPTTLSIKPLGTISPVLNRKLVGGSHPPPPKISSKEGTKPSALKTSEVTDPV
QVSKPTQGSTFKPPVPPRPQVKVPLPSADTPNQAEPDVLVEKPEKVLLPTPVDKSAEKQA
KCVDHIEDLSTSKQFLAKQEVAKDFTSESSCPTKDSTDDHQTWESSEILYRNKLGKWTRT
RASCLFDIESCHRYLNIALWCRDPFKLGGLICLGHVSLKLEDVALGCLATSNMEYLSTFR
LEAPAPKAMVTRTALRNLSMQKGFNDKFCYGDITVHFKYLKEGEPDHHIVTNIEKEKEPY
LVEEVSTVPKEEHFTGQMSSPENKHSFQDTQFQNPTWCDYCKKKVWTKAASQCMLCAYVC
HKKCQEKCLAETPLCGATERRIDRTLKNLRLEGQEPLLGLPPRVDAETNKSVNKTTGLTR
HIINTSSRLLNLRQVSKTRLSEPGTDLVEPSPKHTPNTSDNEGSDTEVCGPNSPSKRGNS
AGIKLVRKEGGLDDSVFIAVKEIGRDLYRGLPTEERIQKLEFMLDKLQNEIDQELEHNNS
LIREEKETTDIRKKSLLSAALAKSGERLQALTLLMIHYRAGIEDIETLESLSLDQHSKKI
SKYTDEAEEDLDSEISQLIDSQPFSSISDDLFGPSESV
Download sequence
Identical sequences G5BVW1
HGL_H00000334642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]