SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000334657 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000334657
Domain Number 1 Region: 210-273
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000214
Family B-box zinc-binding domain 0.0014
Further Details:      
 
Domain Number 2 Region: 393-494
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000016
Family Fibronectin type III 0.0041
Further Details:      
 
Domain Number 3 Region: 58-101
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000542
Family RING finger domain, C3HC4 0.025
Further Details:      
 
Domain Number 4 Region: 510-700
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000226
Family SPRY domain 0.015
Further Details:      
 
Weak hits

Sequence:  HGL_H00000334657
Domain Number - Region: 161-196
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0324
Family TFIIH p44 subunit cysteine-rich domain 0.077
Further Details:      
 
Domain Number - Region: 259-343
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0405
Family Apolipoprotein A-I 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000334657
Sequence length 724
Comment TRIM46 (Homo_sapiens) tripartite motif-containing 46
Sequence
MRSGGSPHPHRSCVEPGARSRSRDRAPGAAGRAMAEGEDMQTFTSIMDALVRISTSMRNM
EKELLCPVCQEMYKQPLVLPCTHNVCQACAREVLGQQGYLGHGFGTYPGRKRGALHPQVV
MFPCPACQGDVELGERGLAGLFRNLTLERVVERYRQSVSVGGAILCQLCKPPPLEATKGC
TECRATFCNECFKLFHPWGTQKAQHEPTLPTLSFRPKGLMCPDHKEEVTHYCKTCQRLVC
QLCRVRRTHSGHKITPVLSAYQALKDKLTKSLTYILGNQDTVQTQICELEETVRHTEVSG
QQAKEEVSQLVRGLGAVLEEKRASLLQAIEECQQERLARLSTQLQEHQSLLDGSGLVGYA
QEVLKETDQPCFVQAAKQLHNRPLPEPGPLTCPLPEAPVIDTQRTFAYDQIFLCWRLPPH
SPPAWHYTVEFRRTDVPAQQGPTRWQRREEVRGTSALLENPDTGSVYVLRVRGCNKAGYG
EYSEDVHLHTPPAPVLHFFLDGRWGASRERLAISKDQRAVRSVPGLPLLLAAERLLTGCH
LSVDVVLGDVAVTQGRSYWACAVDPASYLVKVGVGLESKLQESFQGAPDVISPRYDPDSG
HDSGAEDATVEAAPPFAFLTIGMGKILLGSGASANAGLTGRDGPAASCTVPLPPRLGICL
DYERGRVSFLDAVSFRGLLECPLDCSGPVCPAFCFIGGGAVQLQEPVGTKPERKVTIGGF
AKLD
Download sequence
Identical sequences G5BDF1
HGL_H00000334657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]