SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000334800 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000334800
Domain Number 1 Region: 35-119
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.04e-35
Family SCAN domain 0.0000753
Further Details:      
 
Domain Number 2 Region: 381-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.26e-20
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 3 Region: 342-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.81e-18
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 4 Region: 465-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000119
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Weak hits

Sequence:  HGL_H00000334800
Domain Number - Region: 222-254
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000183
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000334800
Sequence length 529
Comment ZNF498 (Homo_sapiens) zinc finger protein 498
Sequence
MLKECPGMAEDPQHQMGVPVVKLEKELLWGRGREDSSPETFRLRFRQFRYQEAAGPQEAL
RELQELCRQWLRPELHTKEQILELLVLEQFLTILPREFYAWIREHSPESGKALVEDLTDS
TVDAKAVPCHVQGEQQETVIGRGAWEPGVHLGPVEVKPEWGMPSGEGVQGLDQSTEEQLR
QDPGGGTQAFQEQALPILQVGPSLPPVGTRHQVMGAGFLAVGSQGMAPFKDMALAFPEEE
WRHVTPAHIDCFGEYVEPQDCGISPGVGNKEKEAKLQQEDLKGAFAGLTSERFGETAVQG
PGLGQSCDQEPRGSGSGLPVLPASQHSVPVPDDLKTHSSFWKPFQCPECGKGFSRSSNLV
RHQRTHEEEKSYGCMECGKGFTLREYLMKHQRTHLGKRPFVCNECWKTFSQRHHLEVHQR
SHTGEKPYKCGDCWKSFSRRQHLQVHRRTHTGEKPYTXAVHRRAHTGERSRGCQVCGKCF
SKGERLVRHQRIHTGEKPYHCLACGRSFNQRSILNRHQKTQHRQEPPLQ
Download sequence
Identical sequences G5AX98
HGL_H00000334800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]