SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000334853 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000334853
Domain Number 1 Region: 311-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.47e-22
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 2 Region: 199-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.56e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 255-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 4 Region: 479-536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.07e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 367-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.21e-21
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 6 Region: 521-573
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.86e-20
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 7 Region: 2-45
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-19
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 8 Region: 409-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.38e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 9 Region: 161-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000112
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000334853
Sequence length 618
Comment ZNF555 (Homo_sapiens) zinc finger protein 555
Sequence
DSVVFEDVAVQFTQEEWALLDSAQRDLYRDVMLETFWNLASINDESQFKARDSVSQQDIY
GEKIPKKPEIAKLTKNDSWASAFGKIWEDFAFEDQHTGQGRNLRNETVETFCGSNGKCID
TFSQIPNLNLHKRITTGAKQYRKMMQRLSSKGRITIHTGHKPYQCQEFGEAYSCHSYLRA
HVRAHNGERPYACELCEKTFPRTSSLNRHVRTHTAEKNYECQHCGKAFIDFSSLNSHLRS
HTGEKPYKCTECGKTFSYSSTFRRHTITHTGEKPYKCKECGNAFSYSSTFRRHMISHTGE
KPHKCKECGEAFSYSSAFRRHAITHSGEKPHECKQCGKTFIYLQSFRRHERIHTGEKPYE
CRECGKAFIYPQSFRRHERTHGGKKPYECTQCGKTFSHPSSFQGHMRVHTGDKPYDCKQC
GKTFNWPISLRKHMRIHDREKPYQCIQCGKTFSLSACFQDQVRIHPEDQSYQCKLCGKAF
YCHISLQKHMRRHTAEKLYKCKECGKAFSWPELLQQHVRTHTNEKPYKCKECGKVFKWPS
SLPVHMRLHSGEKPYQCKECEKAFNCSSSLRRHMRIHFAEKQYTCDVGHPPESEFMYSVP
QNAPQDSNLIKVVNMALP
Download sequence
Identical sequences G5AKQ7
HGL_H00000334853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]