SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000335060 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000335060
Domain Number 1 Region: 14-330
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 8.63e-48
Family Extradiol dioxygenases 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000335060
Sequence length 343
Comment HPDL (Homo_sapiens) 4-hydroxyphenylpyruvate dioxygenase-like
Sequence
MDDVTGAPGGAGGGRPVALRSGDAVFLVNEGAGAGDPLYGVDPRHPVPSATNLCFDVEDL
DAAVRALAAQGCRVPVPPVSVKDVQGTVTYAVLSSPAGNLSLTLMARAGYRGLFLPGFRP
VRSAPGPGWVSHVDHLTLACTAGSSPALRRWFHDCLGFHHLPLSPGEDPELGLEVAAGSG
RGGLRLTALQTPPGTAVPTLVLAESLPGATSRPDQVEQFLARHRGPGLQHVGLYTPSILE
AAKGMVVAGGRLLTPPKAYYQQPGKEGQIRAAGHKPSLLAQQGILIDGDKGKFLLQVFTK
SLFAEDTFFLELIERQGATGFGQNNIRALWQSVQEEATRDQET
Download sequence
Identical sequences G5ARU2
HGL_H00000335060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]