SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000335194 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000335194
Domain Number 1 Region: 90-206
Classification Level Classification E-value
Superfamily FKBP-like 4.52e-33
Family FKBP immunophilin/proline isomerase 0.00025
Further Details:      
 
Domain Number 2 Region: 209-275
Classification Level Classification E-value
Superfamily EF-hand 0.00000000242
Family Calbindin D9K 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000335194
Sequence length 280
Comment FKBP7 (Homo_sapiens) FK506 binding protein 7
Sequence
MRTAPEATRSTITGQGSGGAHVPPSGKEGGSRPPAPQSSETGTEPEMKARDRGRNPEETG
YNMQTRPGKQRDYEALSEILRTGQKKEESTEEVKIEVVYRPENCSKTSKKGDLLNAHYDG
YLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMMHMCPGEKRKVIIPPSFAYGKE
GYAEAKIPPDATLIFEIELYAVTKGPRSVETFKQIDADNDRRLSKTEVSHYLEREFEKDE
KPRDKSYQNAVLEDFFKKNDHDGNGFISPKEYNVYQHDEL
Download sequence
Identical sequences G5B0U3
HGL_H00000335194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]