SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000335614 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000335614
Domain Number 1 Region: 972-1037
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000893
Family SAM (sterile alpha motif) domain 0.069
Further Details:      
 
Domain Number 2 Region: 843-919
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000105
Family SAM (sterile alpha motif) domain 0.027
Further Details:      
 
Domain Number 3 Region: 1045-1119
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000018
Family SAM (sterile alpha motif) domain 0.078
Further Details:      
 
Weak hits

Sequence:  HGL_H00000335614
Domain Number - Region: 231-384
Classification Level Classification E-value
Superfamily Tropomyosin 0.00255
Family Tropomyosin 0.0037
Further Details:      
 
Domain Number - Region: 412-453
Classification Level Classification E-value
Superfamily BAS1536-like 0.0536
Family BAS1536-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000335614
Sequence length 1206
Comment PPFIA3 (Homo_sapiens) protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 3
Sequence
MMCEVMPTISEDGRRGSALGPDEAGGELERLMVTMLTERERLLETLREAQDGLATAQLRL
RELGHEKDSLQRQLSIALPQEFAALTKELNLCREQLLEREEEIAELKAERNNTRLLLEHL
ECLVSRHERSLRMTVVKRQAQSPGGVSSEVEVLKALKSLFEHHKALDEKVRERLRMALER
VAVLEEELELSNQETLSLREQLSRRRSGLEEPGKDGDGQTLANGLGPDSSRRTAELEEAL
ERQRAEVCQLRERLAVLCRQMSQLEEELGTAHRELGKAEEANSKLQRDLKEAAELEEARE
RQRAEALAQREDMEERITTLEKRYLSAQREATSLHDANDKLENELASKESLYRQSEEKSR
QLAEWLDDAKQKLQQTLQKAETLPEIEAQLAQRVAALNKAEERHGNFEERLRQLEAQLEE
KNQELQRARQREKMNDDHNKRLSETVDKLLSESNERLQLHLKERMGALEEKNSLSEEIAN
MKKLQDELLLNKEQLLAEMERMQMEIDQLRGRPPSSYSRSLPGSALELRYSQAPTLPSGA
PLDPYGAGSGRAGKRGRWSGVKDEPSKDWERSTPAGSMPPPFPGELDGSDEEEAEGMFGA
ELLSPSGQADVQTLAIMLQEQLEAINKEIKLIQEEKETTEQRAEELESRVSSSGLDSLGR
YRSSCSLPPSLTTSPLASPSPPSSGHSTPRLAPPSPAREGTDKANHVPREEVCAPRGEGP
AIPGDTPPPTPRSARLERMTQALALQAGSLEDGGPSRGSEGTPDSLHKAPKKKSIKSSIG
RLFGKKEKGRMGPPGRDSSSLAGTPSEETLAADPLGLAKLTGPGDKDRRNKRKHELLEEA
CRQGLPFAAWDGPTVVSWLELWVGMPAWYVAACRANVKSGAIMANLSDTEIQREIGISNP
LHRLKLRLAIQEMVSLTSPSAPASSRTPTGNVWMTHEEMESLTAATKPETKEISWEQILA
YGDMNHEWVGNDWLPSLGLPQYRSYFMESLVDARMLDHLNKKELRGQLKMVDSFHRVSLH
YGIMCLKRLNYDRKDLERRREESQTQIRDVMVWSNERVMGWVSGLGLKEFATNLTESGVH
GALLALDETFDYSDLALLLQIPTQNAQARQLLEKEFSNLISLGTDRRLDEDSAKSFSRSP
SWRKMFREKDLRGVTPDSAEMLPPNFRSAAAGALGSXXLPLRKLQPEGQTSGSSRADGVS
VRTYSC
Download sequence
Identical sequences HGL_H00000335614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]