SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000336565 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000336565
Domain Number 1 Region: 22-109
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.65e-34
Family SCAN domain 0.0000215
Further Details:      
 
Domain Number 2 Region: 397-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000213
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 3 Region: 268-299
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000235
Family KRAB domain (Kruppel-associated box) 0.0036
Further Details:      
 
Domain Number 4 Region: 342-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000123
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000336565
Sequence length 452
Comment ZNF446 (Homo_sapiens) zinc finger protein 446
Sequence
MPSPLGPSYLPLGDSETNLKGPEGARLRFRGFCYKEVAGPREALAQLRELCHQWLRPESC
SKEEILELLVLEQFLGTLPLEIQAWVRRQQPGCPEEAAALVEGLQQDPGQLLGWITAHIL
KPEVLPASQKTEESSGSPQPSATVDPCGAAPGEGPQDARMEGSAQLSCSVKEEPSVDGQE
MAPLSPLLPAPSPESHLEHQEPASTSFQLPRNQYQSPTHKPQGVPLHLSRVLLDLPPQQG
IPVSRNKADPLQVTEEGHPFLAMTVASPQERWVLLDRSQKELYWDAMLQKYGSAVSLGED
RFALGPQAPLPVRVYACLMAPSAGLPDREPNPDPELSPRPAHQDLPTARKPYTCAQCGCG
FDWKSVFVMHRRSHARAPEPVPPPCAPRSTPRRAPGHVCQDCGHSFSWKSQLVIHRKAHA
GQRRHACGDCGRAFDWKSQLVIHRKSHQPEAL
Download sequence
Identical sequences G5B3F9
HGL_H00000336565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]