SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000337053 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000337053
Domain Number 1 Region: 358-591
Classification Level Classification E-value
Superfamily HCP-like 2.35e-47
Family HCP-like 0.00017
Further Details:      
 
Domain Number 2 Region: 565-699
Classification Level Classification E-value
Superfamily HCP-like 9.68e-26
Family HCP-like 0.0059
Further Details:      
 
Domain Number 3 Region: 198-322
Classification Level Classification E-value
Superfamily HCP-like 2.44e-24
Family HCP-like 0.0034
Further Details:      
 
Domain Number 4 Region: 116-169
Classification Level Classification E-value
Superfamily Kringle-like 2.51e-19
Family Fibronectin type II module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000337053
Sequence length 793
Comment SEL1L (Homo_sapiens) sel-1 suppressor of lin-12-like (C. elegans)
Sequence
MQVRVGLTLLLCAVLLGSASPSSDEEGNQDESLDSKTSLPSDESVKDHTTTGRVVAGQIF
VDSEESELESPIQEEENSLKSQEGKSATEEISFLESPNPEKDYEAPKKVRKPALTAIEGT
AHGEPCHFPFLFLDMEYVACTSDGREDGRLWCATTYDYGTDEKWGFCETEEEAARRRQME
EAEMLYQTGMKILNGSNKKSQKREAYRYLQKAASMNHTKALERVSYALLFGDYMTQNIQA
AKEMFEKLTEDGSPKGQTGLGFLYASGLGVNSSQAKALVYYTFGALGGNLIAHMVLGYRY
WAGIGVLQSCESALTHYRLVANHVASDISLTGGSVVQRIRLPDEVENPGMNSGMLEEDLI
QYYQFLAEKGDVQAQVGLGQLHLHGGRGVEQNHQRAFDYFNLAANAGNSHAMAFLGKMYS
EGSDIVPQSNETALHYFKKAADMGNPVGQSGLGMAYLYGRGVQVNYDLALKYFQKAAEQG
WVDGQLQLGSMYYNGIGVKRDYKQALKYFNLASQGGHILAFYNLAQMHASGTGVMRSCHT
AVELFKNVCERGRWSERLMTAYNSYKDGGYNAAVIQYLLLAEQGYEVAQSNAAFILDQKE
ATIVDENETYPRALLHWNRAASQGYTVARIKLGDYHFYGFGTDVDYETAFIHYRLASEQQ
HSAQAMFNLGYMHEKGLGIKQDIHLAKRFYDMAAEASPDAQVPVFLALCKLGVVYFLQYI
RETNIRDMFTQLDMDQLLGPEWDLYLMTIIALLLGTVIAYRQRQHQDLPVPRPPGPRPAP
PQQEGPPEQQPPQ
Download sequence
Identical sequences G5AJR8
HGL_H00000337053 XP_004837157.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]