SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000337056 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000337056
Domain Number 1 Region: 9-162
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.86e-50
Family Ankyrin repeat 0.000000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000337056
Sequence length 166
Comment CDKN2D (Homo_sapiens) cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
Sequence
MMLEEVRAGDRLSGAAARGDVQEVRRLLYRELVHPDALNRFGKTALQVMMFGSLTIAQEL
LKQGASPNIQDASGTSPVHDAARTGFLDTLKVLVEYGADVNMPDGTGSLPIHLAVREGHA
SVVSFLAPESDLHHRDAAGLTPLELARQRGAQDLLDILQGHKVIPL
Download sequence
Identical sequences G5BUH4
XP_004865566.1.39548 HGL_H00000337056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]