SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000337281 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000337281
Domain Number 1 Region: 12-345
Classification Level Classification E-value
Superfamily Ras GEF 4.45e-88
Family Ras GEF 0.00031
Further Details:      
 
Domain Number 2 Region: 416-476
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.28e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00099
Further Details:      
 
Domain Number 3 Region: 350-430
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000226
Family Calmodulin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000337281
Sequence length 640
Comment RASGRP3 (Homo_sapiens) RAS guanyl releasing protein 3 (calcium and DAG-regulated)
Sequence
MEASADYRNGWYWILKFPAEFNLDLGLIRMTEEFREVASQLGYEKHVSLIDISSIPSYDW
MRRVTQRKKVSKKGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYVIHGCLENN
PTLERSIALFNGISKWVQLMVLSKPTPQQRAEVITKFINVAKKLLQLKNFNTLMAVVGGL
SHSSISRLKETHSHLSSEVTKNWNEMTELVSSNGNYCSYRKAFADCDGFKIPILGVHLKD
LIAVHVIFPDWMEENKVNIVKMHQLSITLSELVSLQNASHHLEPNMDLINLLTLSLDLYH
TEDDIYKLSLVLEPRNSKSQPTSPTTPTKSVVPLDWASGVMPKPDPTVINKHIRKLVESV
FRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLRAKSQLHCK
MGPGFVHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLLVLACRRFS
RAPSLGSSQGSLPGSPSLPPVQDEVFEFPGVTAEHRDLDSRAITLVTGSSRKISVRLQRA
TTSQATQTEPVWSEAGWGDSGSHTFPKMKSKFHGKAAKDKGFAKWENEKPRVQAGVDVVD
RGTEFEPDQDEVLDETRQDGEVSAGPNRRENQKGRLKGLR
Download sequence
Identical sequences G5B3X8
HGL_H00000337281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]