SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000337363 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000337363
Domain Number 1 Region: 38-114
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.39e-32
Family SCAN domain 0.0000872
Further Details:      
 
Domain Number 2 Region: 322-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-20
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 360-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.99e-19
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 418-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.87e-19
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 5 Region: 460-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-18
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 6 Region: 120-177
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000301
Family KRAB domain (Kruppel-associated box) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000337363
Sequence length 517
Comment ZNF394 (Homo_sapiens) zinc finger protein 394
Sequence
MAASSGVAAPLPPEEVVVKVEEDSRGVLQSDAPGACADPESSRRQFRQLSYREVAGPEDA
LSRLRELCRRWLRPELHSKEQILELVVLEQFLSILPGELQAWVRGHYPESGEEASPARAA
PQGLVTLEAVSVTWEEWEHLDAAQRDFHRESSHKDYQSMVLPSLETRAENKELIPKQKIL
EVKPQPWLQEVSQGKGPRFSECGSTHEHRVEKQPTDFMSLKHKNSEEQGLTSISNLNTNG
STERVSKSKEFGNRARSSSFILVQHNQTVSRSIDGKEHGNKHKQSLDTVKCHTVKTHNSV
DSGDSVPCSGLFETQTRFCEERPYKCDNCEKSFKQRSDLFKHQRIHTGEKPYECQECGKS
FSQSAALIKHQRTHTGEKPYACLQCGECFRQSSHLNRHQRTHAGEKYCKCEGCEKTSHSS
VFKPQRLHNGERRYKCEECEKSFKQSSDLFKHQRIHTGEKPYGCSFCGKSFSQSATLIKH
RRTHTGEKPYKCLECGRCFRQSTHLIRHQRIHQNKGP
Download sequence
Identical sequences G5AX95
HGL_H00000337363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]