SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000337555-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000337555-2
Domain Number 1 Region: 279-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.64e-24
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 335-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.35e-22
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 3 Region: 391-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.43e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 4 Region: 1-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.09e-20
Family KRAB domain (Kruppel-associated box) 0.0026
Further Details:      
 
Domain Number 5 Region: 223-279
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-20
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 432-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.85e-19
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 7 Region: 185-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000103
Family Classic zinc finger, C2H2 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000337555-2
Sequence length 522
Comment ZNF548 (Homo_sapiens) zinc finger protein 548
Sequence
QGRVVFEDVAIYFSQEEWGHLSEAQRLLYCDVMLENLALLSSLGCWHGAKDEEALFEQGI
SVGASQVTTPKPGSSTEKTQPRESLLKDILHLAEHSRTQTEQEMYLCEAELYQPYKQNLS
RGDSWRLSFLKNHRIHMAERTFTCKEGWKEAPATSGLLQHQAPCCVWKPNMETQGMEALP
ARHNNYTCSKCGKAFRCKYSLDEHEKTHTGERPYQCSKCGKFFRYNANFMKHQSIHSGER
TYECRECGKSFMYNYRLMRHKRVHTGERPYECDICGKFFRYSSTFFRHQRVHTGERPYEC
NVCGKFFMDSSTLIKHQRVHTGERPYKCSECGKFFRYHSTLIRHQRLHSGEKPYECSICG
EFFRYNSSLVKHWRNHTGERPYKCSECGKCFRYHCRLIRHQRVHTGERPYECSQCGKFFR
YNSNLIKHWRNHTGERPYECRECGKAFSHKHILVEHQKIHTGERPYECNECRKAFIRKSH
LVHHQKIHNEESLVCSENVRNSIGTTPASLNIRDFTMEKIYH
Download sequence
Identical sequences G5C8I0
HGL_H00000337555-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]