SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000337605 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000337605
Domain Number 1 Region: 2-133
Classification Level Classification E-value
Superfamily PX domain 5.63e-35
Family PX domain 0.000000319
Further Details:      
 
Domain Number 2 Region: 160-221
Classification Level Classification E-value
Superfamily SH3-domain 5.25e-18
Family SH3-domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000337605
Sequence length 260
Comment NCF4 (Homo_sapiens) neutrophil cytosolic factor 4, 40kDa
Sequence
SDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFYALQSKLE
ERYGPENKSSPTTCSLPVLPAKVYMGVKQEIAEMRIPALNAYMKNLLSLPVWVLMDADVR
IFFYQSPYDSEQVPQALRRLRPRTRKVKNMSPQGTSFDHLAAPRAEALFDFTGNSKLELN
FKAGDVIFLLSRVNKDWLEGTAKGATGIFPVSFVKILKDFPEEDDPTNWLRCYYYEDTIS
TIKFVAGWEKGLGHSPATLP
Download sequence
Identical sequences G5BAW0
HGL_H00000337605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]