SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000337724 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000337724
Domain Number 1 Region: 39-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 8.24e-39
Family SCAN domain 0.0000479
Further Details:      
 
Domain Number 2 Region: 482-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 584-635
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.76e-18
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 399-440,468-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.82e-17
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 5 Region: 231-289
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000497
Family KRAB domain (Kruppel-associated box) 0.0038
Further Details:      
 
Domain Number 6 Region: 538-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000605
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000337724
Sequence length 640
Comment ZNF202 (Homo_sapiens) zinc finger protein 202
Sequence
MATALETEDQDLWEEEGILMVKLEDDFTCRPESVLQRDDPVLETSHQNFRRFRYQEAASP
REALIRLRELCHQWLRPERRTKEQILELLVLEQFLTVLPGELQSWVRGQRPESGEEAVTL
VEGLQKEPRRPRRWVTVHVHGQEVLSEETLHLGAEPESPSELKDPAQTSSPEQSHEEANQ
SPDQGTPERQSLHCEEELQPLQENEVPVLQDPDPPAERRSGDPEMVALLTALSQGLVTFK
DVAVCFSQDQWSDLDPTQKEFYGEYVLEEDCGIVVSLSFPIPRLDDISQVPDIHEPQEPE
EPEILSFTYTGDRSEDEEENVGQEVLTLEDVHRSNLGDPEIHRTPDWEIVFEDNPDRTNE
RRCGTNISQVDSFLNLQETIPVHPLLGKQHECPVCRKNFTCNSHLIRHLRTHTGEKPYKC
MECGKSYTRSSHLARHQKVHKVNTYKYPLNQKNVDKTSPLNHGERTPSVEKPHRCNDCGK
HFRWTSDLVRHQRTHTGEKPFFCTVCGKSFSQKSVLTTHQRIHLVGKSYLCGECGENFSD
HRRYLAHQKTHAAEELYLCSKCGRCFNDSTAFAKHLRGHTSVRQCRCTECGKSFSRRDHL
VRHQRTHTGEKPFTCPTCGKSFSRGYHLIRHQRTHSAKTS
Download sequence
Identical sequences G5C5A4
HGL_H00000337724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]