SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000338352-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000338352-1
Domain Number 1 Region: 1-115
Classification Level Classification E-value
Superfamily Nudix 2.84e-21
Family MutT-like 0.0000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000338352-1
Sequence length 149
Comment NUDT4P1 (Homo_sapiens) nudix (nucleoside diphosphate linked moiety X)-type motif 4 pseudogene 1
Sequence
QVLLVSSSRYPDQWIFPGGGMEPEEEPGGAAEREVYEEAGVRGKLGRLLGIFEQNQDRKH
RTYVYVLTVTEILEDWEDSVNIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGCSPTN
GNSTVPSLPDNNALFVTAAQSPGLPSSVR
Download sequence
Identical sequences G5B010
HGL_H00000338352-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]