SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000338477-5 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000338477-5
Domain Number 1 Region: 274-363
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.55e-22
Family Canonical RBD 0.00001
Further Details:      
 
Domain Number 2 Region: 99-193
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.39e-22
Family Canonical RBD 0.0000131
Further Details:      
 
Domain Number 3 Region: 5-97
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.46e-19
Family Canonical RBD 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000338477-5
Sequence length 413
Comment HNRNPF (Homo_sapiens) heterogeneous nuclear ribonucleoprotein F
Sequence
MLGPEGGEGYVVKLRGLPWSCSIEDVQNFLSDCTIRDGVAGVHFIYTREGRQSGEAFVEL
ESEDDVKMALKKDRESMGHRYIEVFKSHRTEMDWVLKHSGPNSADTANDGFVRLRGLPFG
CTKEEIVQFFSGLEIVPNGITLPVDPEGKITGEAFVQFASQELAEKALRKHKERIGHRYI
EVFKSSQQEVRSYSDLPLKFMSMQRPGPYDRPGTARRYIGIVKQTGLERMSSGAYSAGYG
GFEYSGLSEGYGFTTDLFGRDLSYCLSGMYDHGFGDGEFTVQSTTGHCVHMRGLPYKATE
NDIYNFFSPLNPMRVHIEIGPDGRVTGEADVEFATHEEAVPAMSKDRANMQHRYIELFLN
STTGASSGAYSSQVIQGMGVSAAQATYRGLESQSVSGCYGASYNSQNSMWGYD
Download sequence
Identical sequences G5C8L7
HGL_H00000338477-5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]