SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000338572 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000338572
Domain Number 1 Region: 424-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.79e-19
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 2 Region: 311-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000169
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 3 Region: 153-181
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000222
Family KRAB domain (Kruppel-associated box) 0.0076
Further Details:      
 
Weak hits

Sequence:  HGL_H00000338572
Domain Number - Region: 40-110
Classification Level Classification E-value
Superfamily Tropomyosin 0.00219
Family Tropomyosin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000338572
Sequence length 491
Comment ZNF212 (Homo_sapiens) zinc finger protein 212
Sequence
QHRRKRRSTPLTTSMPPSQATEKSPYFQTTEISLWTVVAALQAVEKKMESQAAQLQSLEG
RAGTAEKKLADCEKTAVELGNQLEGKWAVLGTLLQEYGLLQRRLENMENLLRNRNFWVLR
LPPGSKGEAPKVSRALENDGVCFSEQXXXXXXXWENLADWQKELYRNVMQSNYEALVSLK
VLGQPEGEAELGAEMLGDLEEEGLVGAHPADGTVLRPEVPSQLEGCMFPGAAEEPDFLGP
VQTELWDGQGSSALLEPGPGDSNLEEPLEGSRDPATGRTLGCSPNQKSHRQAQLGQECGQ
GLKLKRSNSGPYECSECDISFCYKQQLAAHLRGHMGWASYPDAEPEESLRPRPQLKPQAK
RAKLHRCDVCQKSFSCRVSLVTHQRCHLQEGPSAGPRIQERFSPNSLVALPGHIPWRKSR
SSLVCGYCGKSFSHPSDLVRHQRIHTGERPYSCPECDKSFVQKQHLLQHQKIHQRERGGP
GPEPGRPNSLL
Download sequence
Identical sequences G5AMM2
HGL_H00000338572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]